Anti-h Inhibin beta A 9504 SPTN-5
Catalog Number: 100709
Key Features
Liquid, may turn slightly opaque during storage
Mouse
Human
FIA
Custom Quote
- Bulk or bespoke? We IVDo that
Request a call back - to discuss your information requirements
Key Documents
Product Overview
| Product Name | Anti-h Inhibin beta A 9504 SPTN-5 |
|---|---|
| Catalog Number | 100709 |
| Description | Monoclonal mouse antibody, cultured in vitro under conditions free from animal-derived components. |
| Host Species | Mouse |
| Application | FIA |
| Alternative Names | (click to expand) |
Further Specification
| Form/Appearance | Liquid, may turn slightly opaque during storage |
|---|---|
| Concentration | 5.0 mg/ml (+/- 10 %) |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Epitope | Amino acids 81-112 (CVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEE) |
| Purity | ≥ 95 % |
| Affinity constant | N/D |
| Buffer | 50 mM Na-citrate, pH 6.0, 0.9 % NaCI, 0.095 % NaN3 as a preservative |
| IEF Profile | 7.1–8.5 |
| Cross Reactivity | Not determined |
| Specificity | Antibody recognizes human inhibin beta A subunit, also known as activin beta A |
| Animal-free | Yes |
Storage and Shipping
| Storage | +2–8 °C |
|---|---|
| Shipping | Cold Packs |
| Shelf Life | 36 months |