Anti-h Inhibin beta A 9504 SPTN-5

Catalog Number: 100709

Write Your Own Review
You're reviewing:Anti-h Inhibin beta A 9504 SPTN-5
Your Rating
Key Features

Liquid, may turn slightly opaque during storage

Human

FIA

Qty:
+ -

Custom Quote

Product Overview
Product NameAnti-h Inhibin beta A 9504 SPTN-5
Catalog Number100709
DescriptionMonoclonal mouse antibody, cultured in vitro under conditions free from animal-derived components.
ApplicationFIA
BrandMedix Biochemica
Further Specification
Form/AppearanceLiquid, may turn slightly opaque during storage
Concentration5.0 mg/ml (+/- 10 %)
Storage +2-8°C
IsotypeIgG1
ClonalityMonoclonal
EpitopeAmino acids 81-112 (CVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEE)
Purity≥ 95 %
Affinity constantN/D
Buffer50 mM Na-citrate, pH 6.0, 0.9 % NaCI, 0.095 % NaN3 as a preservative
IEF Profile7.1–8.5
Cross ReactivityN/D
SpecificityAntibody recognizes human inhibin beta A subunit, also known as activin beta A
Storage and Shipping
Storage +2-8°C
ShippingCold packs
Shelf Life12 months
Application and References
ApplicationFIA
Reviews