'

Creatine Kinase MM (CK-MM) Antigen, Recombinant >95%

Catalog Number: LA373

Key Features

Purified Recombinant Antigen (His-tag)

ELISA, WB

Qty:
+ -

Custom Quote

Product Overview
Product Name Creatine Kinase MM (CK-MM) Antigen, Recombinant >95%
Catalog Number LA373
Application ELISA, WB
Brand EastCoast Bio
Further Specification
Form/Appearance Purified Recombinant Antigen (His-tag)
Notes Amino Acid Sequence: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQKHHHHHH.
Purity >95% by SDS-PAGE
Buffer 10 mM Phosphate Buffered Saline, pH 7.4
Molecular Weight 44 kDa
Storage and Shipping
Storage Short Term (≤ 1 week): 2-8°C. Long Term: ≤-20°C. Avoid repeated freezing and thawing.
Shipping Cold Packs